Part Number Hot Search : 
00AXC SKM30 RKBPC10 103AL SI1031R 4816N SW601B BD6973FV
Product Description
Full Text Search
 

To Download TM043NVHG01 Datasheet File

  If you can't view the Datasheet, Please click here to try to view without PDF Reader .  
 
 


  Datasheet File OCR Text:
  TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 specification tft lcd module preliminaryspecification finalspecification --------------------------------------------------- --------------------------------------------------- --------------------------- tianma micro-electronics co., ltd address: 8f 64th building jinlong majialong industrial area, nanshan district, shenzh en, china tel: +86-755-26094288 fax: +86-755-86225774 web: www.tianma.cn www.tianma.com --------------------------------------------------- --------------------------------------------------- -------------------------- model no: TM043NVHG01 customer: customer p/n. version v0.1 customer approved preparedby checkedby verifiedby qadept. approvedby
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 revision record version page revisionitems name date 0.1 firstrelease jim 2013.03.21
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 table of contents 1.generalspecifications......................... ................................................... ....................................3 2. input/outputterminals........................ ................................................... ..................................5 2.1tftlcdpinassignment......................... ................................................... ........................5 2.2ctppinassignment......................... ................................................... .................................6 3.absolutemaximumratings........................ ................................................... ..............................6 4.electricalcharacteristics..................... ................................................... .....................................7 41drivingtftlcd................................ ................................................... ..............................7 4.2drivingctp................................... ................................................... ..................................7 4.3drivingbacklight............................. ................................................... ................................8 5.blockdiagram...........t...................... ................................................... ........................................9 6.tfttimingchart............................... ................................................... ....................................10 7.ctptiming..................................... ................................................... .......................................16 8.opticalcharacteristics........................ ................................................... ...................................20 9.reliabilitytest............................... ................................................... .........................................23 10.mechanicaldrawing............................ ................................................... .................................25 11.productinspectioncriteria.................... ................................................... ................................26 12.precautionsforuseoflcdmodules............. ................................................... .......................31 13.packing........................................ ................................................... .........................................33 14.productpartnumbersystem..................... ................................................... ............................34
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 4 4 1generalspecifications TM043NVHG01isacoloractivematrixlcdmoduleinc orporatingamorphoussilicontft (thinfilmtransistor).itiscomposedofacolort ftlcdpanel,driveric,fpc,abacklight unitandctp(capacitivetouchpanel)withmultito uchfunction.themountingmethodis withtapebonding.thisproductaccordswithrohs environmentalcriterion. item feature spec unit note tft lcd module size 4.3 inch lcdresolution 480(rgb)x272 interface tftlcd:rgb24bits ctp:i2c colordepth 16.7m lcdtechnologytype asitft pixelpitch 0.198x0.198 mm pixelconfiguration r.g.b.verticalstripe lcddisplaymode tmwithnormallywhite surfacetreatment ctp:6hhardness lcduppolarizer:ag(3h) viewingdirection 6oclock grayscaleinversiondirection 12oclock activearea tftlcd:95.04(w)x53.86(h) mm ctp:97.44(w)x56.26(h) mm lcm(wxhxd) 113.44x71.46x4.55 mm controlic ctp:ft5306 tftlcd:hx8257a ctptouchmethod barefinger numberofsimultaneoustouches 5points minimumtoucharea 6 mm fingertouchpitch 13 mm ctpstructure glasslens glasssensor lednumbers 10leds pcs
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 5 5 weight tbd g 2. input/output terminals 2.1 tft lcd pin assignment connectortype:fh2840s0.5sh no symbol i/o description remark 1 vled p backlightcathode 2 vled+ p backlightanode 3 gnd p ground 4 vdd p powersupply 5 r0 i datainput 6 r1 i datainput 7 r2 i datainput 8 r3 i datainput 9 r4 i datainput 10 r5 i datainput 11 r6 i datainput 12 r7 i datainput 13 g0 i datainput 14 g1 i datainput 15 g2 i datainput 16 g3 i datainput 17 g4 i datainput 18 g5 i datainput 19 g6 i datainput 20 g7 i datainput 21 b0 i datainput 22 b1 i datainput 23 b2 i datainput 24 b3 i datainput 25 b4 i datainput 26 b5 i datainput 27 b6 i datainput 28 b7 i datainput 29 gnd p ground 30 dclk i clockforinputdata.datalatchedat rising edgeofthis signal. 31 disp i standbymode. disp=1:normallyoperation. disp=0:standbymode. 32 hsync i horizontalsyncinputwithnegativepolarity.ifun used, pleasepullhighlevel. 33 vsync i vertical sync input with negative polarity. if unus ed, pleasepullhighlevel. 34 de i datainputenable.ifunused,pleasepulll owlevel. 35 nc noconnection 36 gnd p ground. 37 x_r noconnection
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 6 6 38 y_b noconnection 39 x_l noconnection 40 y_t noconnection note1:i/odefinition. iinput,ooutput,ppower/ground,nnoc onnection 2.2 ctp pin assignment connectortype:fh2810s0.5sh pin no. symbol i/o description remark 1~5 gnd p groud 6 vcc p ctppowersupply 7 int o externalinterrupttothehost 8 wakeup i externalinterruptfromthehost 9 scl i/o i2cclockinput 10 sda i/o i2cdatainputandoutput note:i/odefinition. iinput,ooutput,ppower/ground,n noconnection 3. absolute maximum ratings ta=25 item symbol m in m ax unit remark powervoltage vdd(lcd) 0.3 4 v vcc(ctp) 0.3 3.6 v vled+ (backlight) 0 18 v vled=0v operatingtemperature topr 20 70 storagetemperature tstg 30 80 note1 table 3.1 absolute maximum rating note1:80 isthesurfacetemperatureofmodule
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 7 7 electrical characteristics 4.1 .1 driving tft lcd ta=25 item symbol m in t yp m ax unit remark voltageforlogic circuit vdd 3.00 3.30 3.60 v powersupplycurrent idd 13 20 ma input signal voltage lowlevel vil 0 0.3xvdd v r0~r7,g0~g7,b0~b7 , dclk,disp,hsync, vsync,de highlevel vih 0.7xvdd vdd v table 4.1 lcd module electrical characteristics note:totestthecurrentdissipation,useallbla ckpattern. 4.1 .2 driving ctp ta=25 item min typ max unit note powersupplyvoltage 2.8 3.3 3.6 v dc(noiseshouldbe under100mv) powersupplycurrent 6 10 ma input signal voltage lowlevel 0 0.3xvcc v int,wakeup,scl,sda highlevel 0.7xvcc vcc v
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 8 8 structure of touch lens interface application 4.1.3 driving backlight item symbol condition min typ max unit remark forwardvoltage vled i f =20ma 15 16 18 v note1 forwardcurrent i f 20 25 ma backlightpowerconsumption wbl i f =20ma 640 900 mw lifetime i f =20ma 10,000 hrs note3 table 4.1.3 led backlight characteristics note1:i f isdefined foronechannelled.therearetotalthreeledchan nelsinbacklight unit.underlcmoperating,thestableforwardcurren tshouldbeinputted. note2:opticalperformanceshouldbeevaluatedat ta=25 only. note 3:if led is driven by high current, high ambi enttemperature & humidity condition.the life timeofledwillbereduced.operatinglifemeansb rightnessgoesdownto50%initialbrightness. typicaloperatinglifetimeisestimateddata. led connection of backlight
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 9 9 5 .block diagram 4.3 inch 480(rgb)*272 tftpanel blu source+gate driver grayscale manipulation voltage vcom & tcon dc/dc fpc data bus vdd,gnd power blu vled+ vled vsync hsync de dclk disp r[7:0] g[7:0] b[7:0] control signalinput ctp driver:ft5306 fpc i2c interface
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 0 0 6.tft lcdtiming chart 6.1 tft lcd input timing 6.1.1 input setup timing parameter setting vdd=3.3v ta=25 parameter symbol min typ max unit remark dclkcycletime t pw 66.7 ns dclkpulsehighwidth t p w h 26.7 ns dclkpulselowwidth t p w l 26.7 ns desetuptime t de s 10 ns deholdtime t d eh 10 ns hsyncsetuptime t hs 10 ns hsyncholdtime t hh 10 ns vsyncsetuptime t v h s 10 ns vsyncholdtime t v h h 10 ns datasetuptime t ds 10 ns dataholdtime t dh 10 ns dispsetuptime t diss 10 us dispholdtime t dish 10 ms note 1 t r =t f =2ns.t r ,t f isdefined10%to90%ofsignalamplitude. note 2 forparallelinterface,maximumclockfrequencyis 15mhz. table 6.1.1 input setup timing parameters requireme nt 6.1.2 input setup timing diagram
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 1 1 vsync 0.7*vddio t diss 0.7*vddio disp t dish 0.7*vddio 0.3*vddio vsync 0.3*vddio 0.7*vddio t vhs 0.7*vddio t vhh hsync dclk 0.3*vddio hsync 0.3*vddio dclk 0.7*vddio 0.3*vddio t hh t hs dclk 0.7*vddio 0.7*vddio t pwh t pwl t pw 0.7*vddio 0.3*vddio t df t ds invalid invalid 0.7*vddio 0.7*vddio t deh t des de r[7:0] g[7:0] b[7:0] figure 6.1.2 input setup timing diagram 6.1.3 data input timing parameter setting parameter symbol min typ max unit remark
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 2 2 dclkfrequency f clk 9 15 mhz hsyncfrequency 1/t h 17.14 khz vsyncfrequency 1/t v 59.94 hz horizontalcycle t h 525 605 dclk horizontaldisplayperiod t hd 480 dclk horizontalpulsewidth t hp 2 41 41 dclk horizontalbackporch t hb 2 2 41 dclk horizontalfrontporch t hf 2 2 82 dclk verticalcycle t v 285 286 399 hsync verticaldisplayperiod t vd 272 hsync verticalpulsewidth t vp 1 10 11 hsync verticalbackporch t vb 1 2 11 hsync verticalfrontporch t vf 1 2 227 hsync note 1 unit:clk=1/f clk ,h=t h , note 2 itisnecessarytokeept vp +t vb =12andt hp +t hb =43insyncmode.demodeisunnecessarytokeepi t. table 6.1.3 data input timing parameters requiremen t 6.2 data input timing diagram 6.2.1 data input timing diagram under sync mode
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 3 3 figure 6.2.1 data input timing diagram under sync m ode(de=l) 6.2.2 data input timing diagram under de mode
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 4 4 figure 6.2.2 data input timing diagram under de mod e(vsync/hsync=h) 6.3 power on/off sequence 6.3.1 power on sequence figure 6.3.1 power on sequence 6.3.2 power off sequence
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 5 5 figure 6.3.2 power off sequence 7. ctp timing
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 6 6 7.1 i2c interface i2c serial data transfer format i2c master write, slave read i2c master read, slave write 7.2 power on/reset sequence
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 7 7 power on time power on sequence reset sequence 7.3 ctp instruction description(more information r efer to ft5306 datasheet)
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 8 8 address name bit7 bit6 bit5 bit4 bit3 bit2 bit1 bit0 host access op,00h devide_mode devicemode[2:0] rw op,01h gest_id gestureid[7:0] r op,02h td_status numberoftouchpoints[3:0] r op,03h touch1_xh 1 st event flag 1 st touchxposition[11:8] r op,04h touch1_xl 1 st touchxposition[7:0] r op,05h touch1_yh 1 st touchid[3:0] 1 st touchyposition[11:8] r op,06h touch1_yl 1 st touchyposition[7:0] r op,07h reserved op,08h reserved op,09h touch2_xh 2 nd event flag 2 nd touchxposition[11:8] r op,0ah touch2_xl 2 nd touchxposition[7:0] r op,0bh touch2_yh 2 nd touchid[3:0] 2 nd touchyposition[11:8] r op,0ch touch2_yl 2 nd touchyposition[7:0] r op,0dh reserved op,0eh reserved r op,0fh touch3_xh 3 st event flag 3 st touchxposition[11:8] r op,10h touch3_xl 3 st touchxposition[7:0] r op,11h touch3_yh 3 st touchid[3:0] 3 st touchyposition[11:8] r op,12h touch3_yl 3 st touchyposition[7:0] r op,13h reserved op,14h reserved op,15h touch4_xh 4 st event flag 4 st touchxposition[11:8] r op,16h touch4_xl 4 st touchxposition[7:0] r op,17h touch4_yh 4 st touchid[3:0] 4 st touchyposition[11:8] r op,18h touch4_yl 4 st touchyposition[7:0] r op,19h reserved op,1ah reserved op,1bh touch5_xh 5 st event flag 5 st touchxposition[11:8] r op,1ch touch5_xl 5 st touchxposition[7:0] r op,1dh touch5_yh 5 st touchid[3:0] 5 st touchyposition[11:8] r op,1eh touch5_yl 5 st touchyposition[7:0] r
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 1 1 9 9 op,1fh reserved op,20h reserved op,21h touch6_xh 6 st eventflag 6 st touchxposition[11:8] r op,22h touch6_xl 6 st touchxposition[7:0] r op,23h touch6_yh 6 st touchid[3:0] 6 st touchyposition[11:8] r op,24h touch6_yl 6 st touchyposition[7:0] r op,25h reserved op,26h reserved op,27h touch7_xh 7 st eventflag 7 st touchxposition[11:8] r op,28h touch7_xl 7 st touchxposition[7:0] r op,29h touch7_yh 7 st touchid[3:0] 7 st touchyposition[11:8] r op,2ah touch7_yl 7 st touchyposition[7:0] r op,2bh reserved op,2ch reserved op,2dh touch8_xh 8 st eventflag 8 st touchxposition[11:8] r op,2eh touch8_xl 8 st touchxposition[7:0] r op,2fh touch8_yh 8 st touchid[3:0] 8 st touchyposition[11:8] r op,30h touch8_yl 8 st touchyposition[7:0] r op,31h reserved op,32h reserved op,33h touch9_xh 9 st eventflag 9 st touchxposition[11:8] r op,34h touch9_xl 9 st touchxposition[7:0] r op,35h touch9_yh 9 st touchid[3:0] 9 st touchyposition[11:8] r op,36h touch9_yl 9 st touchyposition[7:0] r op,37h reserved op,38h reserved op,39h touch10_xh 10 st eventflag 10 st touchxposition[11:8] r op,3ah touch10_xl 10 st touchxposition[7:0] r op,3bh touch10_yh 10 st touchid[3:0] 10 st touchyposition[11:8] r op,3ch touch10_yl 10 st touchyposition[7:0] r op,3dh reserved op,3eh reserved op,feh log_msg_cnt thelogmsgcount r op,ffh log_cur_cha currentcharacteroflogmessage,willpointtothe next characterwhenonecharacterisread. r
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 0 0 8.optical characteristics item symbol condition min typ max unit remark viewangles t cr 10 R 60 70 degree note2 b 40 50 l 60 70 r 60 70 contrastratio cr =0 400 500 note1 note3 responsetime t on 25 20 30 ms note1 note4 t off chromaticity white x backlightis on 0.265 0.315 0.365 note5 note1 y 0.285 0.335 0.385 red x 0.531 0.581 0.631 y 0.295 0.345 0.395 green x 0.298 0.348 0.398 y 0.531 0.581 0.631 blue x 0.103 0.153 0.203 y 0.045 0.095 0.145 uniformity u 75 80 % note1 note6 ntsc 45 50 % luminance l 150 200 cd/m 2 note7 reflectivity 4 % note8 haze 2 % note8 testconditions: 1. i f =20ma(onechannel),theambienttemperatureis25 . 2. thetestsystemsrefertonote1andnote2. note1:definitionofopticalmeasurementsystem. theopticalcharacteristicsshouldbemeasuredind arkroom.after10minutesoperation,theoptical propertiesaremeasuredatthecenterpointofthe lcdscreen.allinputterminalslcdpanelmust begroundwhenmeasuringthecenterareaofthepan el. note2:definitionofviewinganglerangeandmeasu rementsystem. viewingangleismeasuredatthecenterpointofth elcdbyconoscope(ergo80) item photodetector field contrastratio sr3a 1 luminance chromaticity lumuniformity responsetime bm7a 2 500mm photo detector field lcd panel tft-lcd module the center of the screen
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 1 1 note3:definitionofcontrastratio whitestate:thestateisthatthelcdshoulddr ivebyvwhite. blackstate:thestateisthatthelcdshoulddri vebyvblack. vwhite:tobedetermined vblack:tobedetermined . note4:definitionofresponsetime theresponsetimeisdefinedasthelcdopticalswi tchingtimeintervalbetweenwhitestateand blackstate.risetime(t on )isthetimebetweenphotodetectoroutputintensi tychangedfrom90% to10%.andfalltime(t off )isthetimebetweenphotodetectoroutputintensi tychangedfrom10% to90%. note5:definitionofcolorchromaticity(cie1931) colorcoordinatesmeasuredatcenterpointoflcd. note6:definitionofluminanceuniformity activeareaisdividedinto9measuringareas(refe rfig.2).everymeasuringpointisplacedatthe centerofeachmeasuringarea. luminanceuniformity(u)=lmin/lmax lactivearealengthwactiveareawidth
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 2 2 lmax:themeasuredmaximumluminanceofallmeasure mentposition. lmin:themeasuredminimumluminanceofallmeasure mentposition. note7:definitionofluminance: measuretheluminanceofwhitestateatcenterpoin tonthectp note8:measuringequipments:dms501,pr705.@550n m measuringcondition: afterstabilizingandleavingthepanelaloneat agiventemperaturefor30 min, themeasurementshouldbeexecuted, measuringsurroundings:astable,windlessandda rkroom, measuringtemperature:ta=25 c, 30minafterlightingthebacklight. note2: conformtonationalstandardgb2410 80/astmd1003 61(1997)
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 3 3 9. reliability test no test item condition remarks 1 hightemperature operation ta=+70 , 120hours note1,note6,note7 iec6006821,gb2423.2 2 lowtemperature operation ta=20 , 120hours note1,note7,iec6006821 gb2423.1 3 hightemperature storage ta=+80 , 120hours note1,note7,note8 iec6006821 gb2423.2 4 lowtemperature storage ta=30 , 96hours note1,note7,ec6006821 gb2423.1 5 hightemperature& humiditystorage ta=+65 rh=90 ,120hours note1,note3,note4,note7 iec60068278 gb/t2423.3 6 thermalshock/ solderjointlifetest 30 30min ? 80 30min ,change time:5min,100cycle note1,note9 startwithcoldtemperature endwithhightemperature, iec60068214,gb2423.22 12 esd c=150pf r=330 air:8kv contact:4kv 5times (environment:15 ~35 , 30%~60%.86kpa~106kpa) note2,note5, iec6100042 gb/t17626.2 13 shocktest halfsinewave 60g ,6ms,x,y,z 3timesforeachdirection note2 14 droptest(package state) height:60cm, 1corner,3edges,6surfaces note2,iec60068232 gb/t2423.8 15 surfacehardness 6h jisk5600 16 staticload resistancetest after4.5kgloadf or1minisappliedtothe centerarea(1.0cm2)ofthetouchpanel, therequirementsinopticalcharacteristic andelectricalcharacteristicsshallbe satisfied. nocrackaftertest.
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 4 4 17 dropballtest usethe64gsteel( 25)ballisdropped ontheglasssurfacefrom70cmheightat 1time(glassside) nocrackaftertest. 18 terminalpulltest 90 o direction,weight:500g, nonoperation functionisok notes: 1.thetestresultshallbeevaluatedafterthesam plehasbeenleftatroomtemperatureand humidityfor2hourswithoutload.nocondensation shallbeaccepted.thesamplewillnotbe acceptedifappearthesedefects: 1).airbubbleinthelcd; 2).sealleak 3).nondisplay 4).missingsegments 5).glasscrack 6).crreduction>40% 7).iddincrease>100% 8).brightnessreduction>50% 9).colorcoordinatetolerance>0.05 2.thesamplesofthesetestswillnotbeaccepted ifappearthesedefects: 1).airbubbleinthelcd; 2).sealleak 3).nondisplay 4).missingsegments 5).glasscrack 3.eachtestitemappliesforatestsampleonlyon ce,thetestsamplecannotbeusedagaininany othertestitem. 4.fordampprooftest,purewater(resistance 10m)shouldbeused. 5.incaseofmalfunctiondefectcausedbyesddamag e,ifitwouldberecoveredtonormalstate afterresetting,itwouldbejudgeasagoodpart. 6inthetestofhightemperatureoperationandhig htemperature&humidityoperation,the operationtemperatureisthesurfacetemperatureof module 7 high temperature operation low temperature operation high temperature storage low temperature storage high temperature & humidity operation high temperature & humidity storagewillbeincreasedthetesttimeto1000hour sinthesameconditionstotestouttheabilityof module,andwecannotguaranteethatthemodulewi llnotfailduring1000hours.theseitemstest onlyonce 8.thermalshockwillbechangedthecycleto1000cy clestotestouttheabilityofmodule,andwe cannotguaranteethatthemodulewillnotfailaft erthetest.thisitemtestonlyonce 11
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 5 5 10. mechanical drawing
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 6 6 viewing area x1 x2 y1 y2 figure2 b zone active area(aa) azone:viewingarea(va) 11.product inspection criteria 11.1 classification of defects majordefects(ma):amajordefectreferstoadefe ctthatmaysubstantiallydegrade usabilityforproductapplications,includingallf unctionaldefects(suchasnodisplay, abnormaldisplay,openormissingsegment,shortci rcuit,missingcomponent),outline dimensionbeyondthedrawing,progressivedefectsa ndthoseaffectingreliability. minordefects(mi):aminordefectreferstoadefe ctwhichisnotconsideredtobeable tosubstantiallydegradetheproductapplicationor adefectthatdeviatesfromexisting standardsalmostunrelatedtotheeffectiveuseof theproductoritsoperation,suchas blackspot,whitespot,brightspot,pinhole,black line,whiteline,contrastvariation,glass defect,polarizerdefect,etc. 11.2 definition of inspection range fordotdefectoftftlcdwhichisnot smallerthan3inches,dividingthreeareas tomakeajudgment(accordingtofigure1). aarea:centerofviewingarea barea:peripheryofviewingarea carea:outsideviewingarea forotherdefects,dividingtwoareas tomakeajudgment(accordingfigure2). azone:insideviewingarea bzone:outsideviewingarea x1(a.a~v.a): 0 mm x2(a.a~v.a): 0 mm y1(a.a~v.a): 0 mm y2(a.a~v.a): 0 mm 11.3 inspection items and general notes general notes shouldanydefectswhicharenotspecifiedinthis standardhappen,additionalstandard shallbedeterminedbymutualagreementbetweencus tomerandtianma. viewingareashouldbetheareawhichtianmaguaran tees. limitsampleshouldbepriortothisinspectionsta ndard. viewingjudgmentshouldbeunderstaticpattern. inspectionconditions inspectiondistance:250mm(fromthesample) temperature :255oc inspectionangle :45degreesin 12 oclockdirection(alldefectsinviewingareasho uld beinspectedfromthisdirection) inspectio nitems pinhole,brightspot,blackspot, whitespot,blackline,white line,foreignparticle,bubble thecolorofasmallareaisdifferentfromthe remainder.thephenomenondoesntchangewith voltage contrastvariation thecolorofasmallareaisdifferentfromthe remainder.thephenomenonchangeswithvoltage polarizerdefect scratch,dirt,particle,bubbleonpolarizerorbet ween polarizerandglass dotdefect(tftlcd) thepixelappearsbrightordarkabnormallywhen display functionaldefect nodisplay,abnormaldisplay,openormissing segment,shortcircuit,falseviewingdirection figure1
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 7 7 b a =(a+b)/2( w: width l:length(mm ) a b =(a+b)/2(mm) glassdefect glasscrack,shavedcornerofglass,s urplusglass pcbdefect componentsassemblydefect 11.4 outgoing inspection level outgoinginspection standard inspectionconditions inspection min. max. unit il aql majordefects see9.3generalnotes see 11.5 ii 0. 65 minordefects see9.3generalnotes see 11.5 ii 1.5 note samplingstandardconformstogb2828 11.5 inspection items and criteria inspectionitems judgmentstandard category acceptablenumber azone bzone 1 blackspot, whitespot, brightspot, pinhole,foreign particle,particle inoronglass, scratchonglass a Q 0.10 neglected neglected b 0.10< Q 0.15 2 c 0.15< Q 0.20 1 d 0.20< 0 totaldefectivepoint(b,c) 3 2 blackline,white line,andparticle between polarizerand glass,scratch onglass a w Q 0.01 neglected neglected b 0.01 TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 8 8 used) darkdot 2 d total 2 b brightdot 2 darkdot 3 total 4 tftlcdbetween 3~10.4inches lcd class defect aarea barea carea a brightdot 1 1 neglecte d darkdot 1 2 total 4 b brightdot 2 2 darkdot 2 3 total 6 notes: brightdot:inr g bordarkdisplayfigure,thepixelappearsbright. darkdot:inr g borwhitedisplayfigure,thepixelappearsdark. defectareamustbelessthananhalfsizeofthed ot. 5 bubbleinsidecell anysize none none 6 polarizerdefect (ifpolarizeris used) scratch,damage onpolarizer, particleonpolarizer orbetween polarizerandglass. refertoitem1anditem2. bubble,dentand convex a Q 0.3 neglected neglecte d b 0.3< Q 0.7 2 c 0.7< 0 7 surplus glass stagesurplusglass b Q 0.3mm surrounding surplusglass shouldnotinfluenceoutlinedimensionandassembli ng. 8 opensegmentoropencommon notpermitted 9 shortcircuit notpermitted 10 falseviewingdirection notpermitted 11 contrastratiouneven accordingtothelimitspecim en 12 crosstalk accordingtothelimitspecimen 13 black/whitespot(display) refertoitem1 14 black/whiteline(display) refertoitem2 b w
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 2 2 9 9 inspectionitems judgmentstandard category(application:bzone) acceptabl enumber 15 glass defect crack thefrontofleadterminals a at, b1/5w, c3mm max.3 defects allowed b crackattwosidesoflead terminalsshouldnotcover patternsandalignmentmark surroundingcrackDnoncontact side b TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 0 0 inspectionitems judgmentstandard category(application:bzone) 16 pcb defect componentsoldering: nocoldsoldering short opencircuit burr tinball theflatencapsulationcomponent positiondeviationmustbelessthan 1/3widthofthepin(pic.1) thesheetcomponentdeviation: pindeviatesfromthepadandcontact withthenearcomponentsisnot permitted pic.2 leaddefect: theleadlackmustbelessthan1/3of itswidth; theleadburrmustbelessthan1/3of theseam; impuritiesconnectwiththenearleads isnotpermitted connectorsoldering: solderingtinisatcontactpositionof theplugandsocketisnotpermitted nofoundationisscald seriouscavedistortiononplugand socketcontactpinisnotpermitted w l w/2 component solderingpad component lead l1>0 l2>0 solderingtinisnotpermitinthis are a baseboard hea d socket solderingtinisnotpermitinthis area baseboard
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 1 1 glueonrootofthespeakerreceiver andmotorlead: theinsulativecoatoftheleadmust joinintothepcb;theprotectedglue mustenveloptotheinsulativecoat. 12. precautions for use of lcd modules 12.1 handling precautions 12.1.1thedisplaypanelismadeofglass.donots ubjectittoamechanicalshockby droppingitfromahighplace,etc. 12.1.2ifthedisplaypanelisdamagedandtheliqu idcrystalsubstanceinsideitleaksout, besurenottogetanyinyourmouth,ifthesubsta ncecomesintocontactwith yourskinorclothes,promptlywashitoffusingso apandwater. 12.1.3donotapplyexcessiveforcetothedisplay surfaceortheadjoiningareassince thismaycausethecolortonetovary. 12.1.4thepolarizercoveringthedisplaysurfaceo fthelcdmoduleissoftandeasily scratched.handlethispolarizercarefully. 12.1.5ifthedisplaysurfaceiscontaminated,brea theonthesurfaceandgentlywipeit withasoftdrycloth.ifstillnotcompletelyclea r,moistenclothwithoneofthe followingsolvents: isopropylalcohol ethylalcohol solventsotherthanthosementionedabovemay damagethepolarizer. especially,donotusethefollowing: water ketone aromaticsolvents 12.1.6donotattempttodisassemblethelcdmodule . 12.1.7ifthelogiccircuitpowerisoff,donotap plytheinputsignals. 12.1.8topreventdestructionoftheelementsbyst aticelectricity,becarefultomaintain lead pcb insulativecoat glue
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 2 2 anoptimumworkenvironment. a.besuretogroundthebodywhenhandlingth elcdmodules. b.toolsrequired forassembly,suchassolderingirons,mustbeprop erlyground. c.toreducetheamountofstaticelectricity generated,donotconductassembly andotherworkunderdryconditions. d.thelcdmoduleiscoatedwithafilmtop rotectthedisplaysurface.becare whenpeelingoffthisprotectivefilmsincestatic electricitymaybegenerated. 12.2 storage precautions 10.2.1whenstoringthelcdmodules,avoidexposure todirectsunlightortothelight offluorescentlamps. 10.2.2thelcdmodulesshouldbestoredunderthes toragetemperaturerange.ifthe lcdmoduleswillbestoredforalongtime,therec ommendc onditionis: temperature: 0 40 relativelyhumidity: 80% 10.2.3thelcdmodulesshouldbestoredintheroom withoutacid,alkaliandharmful gas. 12.3 the lcd modules should be no falling and viole nt shocking during transportation, and also should avoid excessive pre ss, water, damp and sunshine.
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 3 3 13.packing drawing(reference)
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 4 4 blis te r ps,e le c tr o s ta tic p r e v e n tio n tr a y ps,e le c tr o s ta tic p r e v e n tio n tbd p c s p r o d u c ts in tbd tr a y blis te r ps,e le c tr o s ta tic p r e v e n tio n tbd fu lltr a y s +tbd e mp ty tr a y e v e r y b o x tbd p c s p r o d u c ts in 1 b o x tbd b o x e s in 1 c a s e tbd p c s in 1 c a s e packingstandards: quantityofproductstobepacka gedinacase:tbd pcs outlooksize(cartonsize):tbd c a r e ma r k caremark: pa c k a g e sig n packagesign: c a s e ma r k r e ma r k bms p.o .n o . pa r tn o . q ty c tn .n o . ttl .c tn .n o . mad ein c h in a
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 5 5 14. module part numbering system tm 043 n v z g 08 ? ? ? ? ? ? ? no. explanation tianma module indicating screen inch:043=4.3inch 057=5.7inch 070=7inch 102=1 0.2inch resolution: 480x240(delta)a 240x400(stripe)l 640x240(delta)b 400x240(stripe)m 960x240(delta)c 480x272(stripe)n 96x64(stripe) d 480x234(stripe)o 128x128(stripe)e 320x480(stripe)p 128x160(stripe)f 480x640(stripe)q 176x220(stripe)g 800x480(stripe)r 240x320(stripe)h 800x600(stripe)s 240x240(stripe)v 1024x768(stripe)t 320x320(stripe)j othersx 320x240(stripe)k
TM043NVHG01 v0.1 t t i i a a n n m m a a m m i i c c r r o o e e l l e e c c t t r r o o n n i i c c s s c c o o . . , , l l t t d d companyconfidential.duplicationordisclosurepro hibited.allrightsreserved 3 3 6 6 product structure: tsp+bl(ccfl)+fpc+m4 a tsp+ b bl(ccfl)+fpc+m4 c bl(led)+fpc+m4 d bl(led)+fpc+m4.dualdisplay e fpc+m4 f m4 g m3 h m2 y m1 j bl(ccfl)+fpc+m4+pcb k bl(led)+fpc+m4+pcb l tsp+bl(ccfl)+fpc+m4+pcb m tsp+bl(led)+fpc+m4+pcb n ctp+bl(led)+fpc+m4 v others x m1:panel(array+cf) m2:panel(array+cf+lc) m3:panel(array+cf+lc+plz) m4:panel(array+cf+lc+plz+driver) product assembly location: shenzheng z shanghai h chengdu c wuhan w product appliction: industryandautomotive:g consume:na series number: 00,01,02,03..........


▲Up To Search▲   

 
Price & Availability of TM043NVHG01

All Rights Reserved © IC-ON-LINE 2003 - 2022  

[Add Bookmark] [Contact Us] [Link exchange] [Privacy policy]
Mirror Sites :  [www.datasheet.hk]   [www.maxim4u.com]  [www.ic-on-line.cn] [www.ic-on-line.com] [www.ic-on-line.net] [www.alldatasheet.com.cn] [www.gdcy.com]  [www.gdcy.net]


 . . . . .
  We use cookies to deliver the best possible web experience and assist with our advertising efforts. By continuing to use this site, you consent to the use of cookies. For more information on cookies, please take a look at our Privacy Policy. X